Anti PTPRQ pAb (ATL-HPA053245)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053245-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PTPRQ
Alternative Gene Name: DFNB84
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035916: 85%, ENSRNOG00000056915: 84%
Entrez Gene ID: 374462
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVITGPTCYLIDVKSVDNDEFNISFIKSNEENKTIEIKDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTFQKIPDEVTK |
| Gene Sequence | AVITGPTCYLIDVKSVDNDEFNISFIKSNEENKTIEIKDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTFQKIPDEVTK |
| Gene ID - Mouse | ENSMUSG00000035916 |
| Gene ID - Rat | ENSRNOG00000056915 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTPRQ pAb (ATL-HPA053245) | |
| Datasheet | Anti PTPRQ pAb (ATL-HPA053245) Datasheet (External Link) |
| Vendor Page | Anti PTPRQ pAb (ATL-HPA053245) at Atlas Antibodies |
| Documents & Links for Anti PTPRQ pAb (ATL-HPA053245) | |
| Datasheet | Anti PTPRQ pAb (ATL-HPA053245) Datasheet (External Link) |
| Vendor Page | Anti PTPRQ pAb (ATL-HPA053245) |