Anti PTPN12 pAb (ATL-HPA007097)

Atlas Antibodies

Catalog No.:
ATL-HPA007097-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, non-receptor type 12
Gene Name: PTPN12
Alternative Gene Name: PTP-PEST, PTPG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028771: 63%, ENSRNOG00000013135: 64%
Entrez Gene ID: 5782
Uniprot ID: Q05209
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGAVTQNKTNISTASATVSAAT
Gene Sequence SVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGAVTQNKTNISTASATVSAAT
Gene ID - Mouse ENSMUSG00000028771
Gene ID - Rat ENSRNOG00000013135
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTPN12 pAb (ATL-HPA007097)
Datasheet Anti PTPN12 pAb (ATL-HPA007097) Datasheet (External Link)
Vendor Page Anti PTPN12 pAb (ATL-HPA007097) at Atlas Antibodies

Documents & Links for Anti PTPN12 pAb (ATL-HPA007097)
Datasheet Anti PTPN12 pAb (ATL-HPA007097) Datasheet (External Link)
Vendor Page Anti PTPN12 pAb (ATL-HPA007097)
Citations for Anti PTPN12 pAb (ATL-HPA007097) – 3 Found
Harris, I S; Blaser, H; Moreno, J; Treloar, A E; Gorrini, C; Sasaki, M; Mason, J M; Knobbe, C B; Rufini, A; Hallé, M; Elia, A J; Wakeham, A; Tremblay, M L; Melino, G; Done, S; Mak, T W. PTPN12 promotes resistance to oxidative stress and supports tumorigenesis by regulating FOXO signaling. Oncogene. 2014;33(8):1047-54.  PubMed
Cao, Xun; Chen, Yan-Zhen; Luo, Ruo-Zhen; Zhang, Lin; Zhang, Song-Liang; Zeng, Jun; Jiang, Yu-Chuan; Han, Yu-Jing; Wen, Zhe-Sheng. Tyrosine-protein phosphatase non-receptor type 12 expression is a good prognostic factor in resectable non-small cell lung cancer. Oncotarget. 2015;6(13):11704-13.  PubMed
Weidemann, Sören A; Sauer, Charlotte; Luebke, Andreas M; Möller-Koop, Christina; Steurer, Stefan; Hube-Magg, Claudia; Büscheck, Franziska; Höflmayer, Doris; Tsourlakis, Maria Christina; Clauditz, Till S; Simon, Ronald; Sauter, Guido; Göbel, Cosima; Lebok, Patrick; Dum, David; Fraune, Christoph; Kind, Simon; Minner, Sarah; Izbicki, Jakob; Schlomm, Thorsten; Huland, Hartwig; Heinzer, Hans; Burandt, Eike; Haese, Alexander; Graefen, Markus; Heumann, Asmus. High-level expression of protein tyrosine phosphatase non-receptor 12 is a strong and independent predictor of poor prognosis in prostate cancer. Bmc Cancer. 2019;19(1):944.  PubMed