Anti PTPMT1 pAb (ATL-HPA040348)

Atlas Antibodies

Catalog No.:
ATL-HPA040348-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, mitochondrial 1
Gene Name: PTPMT1
Alternative Gene Name: DUSP23, MOSP, PLIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110860: 83%, ENSRNOG00000009723: 85%
Entrez Gene ID: 114971
Uniprot ID: Q8WUK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGI
Gene Sequence FRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGI
Gene ID - Mouse ENSMUSG00000110860
Gene ID - Rat ENSRNOG00000009723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTPMT1 pAb (ATL-HPA040348)
Datasheet Anti PTPMT1 pAb (ATL-HPA040348) Datasheet (External Link)
Vendor Page Anti PTPMT1 pAb (ATL-HPA040348) at Atlas Antibodies

Documents & Links for Anti PTPMT1 pAb (ATL-HPA040348)
Datasheet Anti PTPMT1 pAb (ATL-HPA040348) Datasheet (External Link)
Vendor Page Anti PTPMT1 pAb (ATL-HPA040348)