Anti PTPMT1 pAb (ATL-HPA040348)

Atlas Antibodies

Catalog No.: ATL-HPA040348-25

Protein Description: protein tyrosine phosphatase, mitochondrial 1
Gene Name: PTPMT1
Alternative Gene Name: DUSP23, MOSP, PLIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110860: 83%, ENSRNOG00000009723: 85%
Entrez Gene ID: 114971
Uniprot ID: Q8WUK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGI
• Gene Sequence: FRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGI
• Gene ID - Mouse: ENSMUSG00000110860
• Gene ID - Rat: ENSRNOG00000009723
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.