Anti PTH1R pAb (ATL-HPA007978)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007978-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PTH1R
Alternative Gene Name: PTHR, PTHR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032492: 86%, ENSRNOG00000020948: 86%
Entrez Gene ID: 5745
Uniprot ID: Q03431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ |
Gene Sequence | RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ |
Gene ID - Mouse | ENSMUSG00000032492 |
Gene ID - Rat | ENSRNOG00000020948 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PTH1R pAb (ATL-HPA007978) | |
Datasheet | Anti PTH1R pAb (ATL-HPA007978) Datasheet (External Link) |
Vendor Page | Anti PTH1R pAb (ATL-HPA007978) at Atlas Antibodies |
Documents & Links for Anti PTH1R pAb (ATL-HPA007978) | |
Datasheet | Anti PTH1R pAb (ATL-HPA007978) Datasheet (External Link) |
Vendor Page | Anti PTH1R pAb (ATL-HPA007978) |
Citations for Anti PTH1R pAb (ATL-HPA007978) – 1 Found |
Maruyama, Hiroki; Taguchi, Atsumi; Mikame, Mariko; Lu, Hongmei; Tada, Norihiro; Ishijima, Muneaki; Kaneko, Haruka; Kawai, Mariko; Goto, Sawako; Saito, Akihiko; Ohashi, Riuko; Nishikawa, Yuji; Ishii, Satoshi. Low bone mineral density due to secondary hyperparathyroidism in the Gla(tm)Tg(CAG-A4GALT) mouse model of Fabry disease. Faseb Bioadvances. 2020;2(6):365-381. PubMed |