Anti PTGES pAb (ATL-HPA045064 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045064-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PTGES
Alternative Gene Name: MGST-IV, MGST1-L1, MGST1L1, PIG12, TP53I12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050737: 86%, ENSRNOG00000006320: 91%
Entrez Gene ID: 9536
Uniprot ID: O14684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM |
Gene Sequence | ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM |
Gene ID - Mouse | ENSMUSG00000050737 |
Gene ID - Rat | ENSRNOG00000006320 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PTGES pAb (ATL-HPA045064 w/enhanced validation) | |
Datasheet | Anti PTGES pAb (ATL-HPA045064 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PTGES pAb (ATL-HPA045064 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PTGES pAb (ATL-HPA045064 w/enhanced validation) | |
Datasheet | Anti PTGES pAb (ATL-HPA045064 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PTGES pAb (ATL-HPA045064 w/enhanced validation) |
Citations for Anti PTGES pAb (ATL-HPA045064 w/enhanced validation) – 3 Found |
Camacho, Mercedes; Dilmé, Jaume; Solà-Villà, David; Rodríguez, Cristina; Bellmunt, Sergi; Siguero, Laura; Alcolea, Sonia; Romero, José-María; Escudero, José-Román; Martínez-González, José; Vila, Luis. Microvascular COX-2/mPGES-1/EP-4 axis in human abdominal aortic aneurysm. Journal Of Lipid Research. 2013;54(12):3506-15. PubMed |
Dilmé, Jaime-Félix; Solà-Villà, David; Bellmunt, Sergi; Romero, José-María; Escudero, José-Román; Camacho, Mercedes; Vila, Luis. Active smoking increases microsomal PGE2-synthase-1/PGE-receptor-4 axis in human abdominal aortic aneurysms. Mediators Of Inflammation. 2014( 24876670):316150. PubMed |
Cao, Yubo; Lu, Xiaomei; Li, Yue; Fu, Jia; Li, Hongyuan; Li, Xiulin; Chang, Ziyou; Liu, Sa. Identification of a six-gene metabolic signature predicting overall survival for patients with lung adenocarcinoma. Peerj. 8( 33344071):e10320. PubMed |