Anti PTDSS1 pAb (ATL-HPA016852)

Atlas Antibodies

Catalog No.:
ATL-HPA016852-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatidylserine synthase 1
Gene Name: PTDSS1
Alternative Gene Name: KIAA0024, PSS1, PSSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021518: 93%, ENSRNOG00000052289: 88%
Entrez Gene ID: 9791
Uniprot ID: P48651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK
Gene Sequence AEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK
Gene ID - Mouse ENSMUSG00000021518
Gene ID - Rat ENSRNOG00000052289
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTDSS1 pAb (ATL-HPA016852)
Datasheet Anti PTDSS1 pAb (ATL-HPA016852) Datasheet (External Link)
Vendor Page Anti PTDSS1 pAb (ATL-HPA016852) at Atlas Antibodies

Documents & Links for Anti PTDSS1 pAb (ATL-HPA016852)
Datasheet Anti PTDSS1 pAb (ATL-HPA016852) Datasheet (External Link)
Vendor Page Anti PTDSS1 pAb (ATL-HPA016852)
Citations for Anti PTDSS1 pAb (ATL-HPA016852) – 1 Found
Brum, Andrea M; van der Leije, Cindy S; Schreuders-Koedam, Marijke; Verhoeven, Jeroen; Janssen, Mark; Dekkers, Dick Hw; Demmers, Jeroen Aa; Eijken, Marco; van de Peppel, Jeroen; van Leeuwen, Johannes Ptm; van der Eerden, Bram Cj. Identification of Chloride Intracellular Channel Protein 3 as a Novel Gene Affecting Human Bone Formation. Jbmr Plus. 2017;1(1):16-26.  PubMed