Anti PTDSS1 pAb (ATL-HPA016852)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016852-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PTDSS1
Alternative Gene Name: KIAA0024, PSS1, PSSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021518: 93%, ENSRNOG00000052289: 88%
Entrez Gene ID: 9791
Uniprot ID: P48651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK |
| Gene Sequence | AEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK |
| Gene ID - Mouse | ENSMUSG00000021518 |
| Gene ID - Rat | ENSRNOG00000052289 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTDSS1 pAb (ATL-HPA016852) | |
| Datasheet | Anti PTDSS1 pAb (ATL-HPA016852) Datasheet (External Link) |
| Vendor Page | Anti PTDSS1 pAb (ATL-HPA016852) at Atlas Antibodies |
| Documents & Links for Anti PTDSS1 pAb (ATL-HPA016852) | |
| Datasheet | Anti PTDSS1 pAb (ATL-HPA016852) Datasheet (External Link) |
| Vendor Page | Anti PTDSS1 pAb (ATL-HPA016852) |
| Citations for Anti PTDSS1 pAb (ATL-HPA016852) – 1 Found |
| Brum, Andrea M; van der Leije, Cindy S; Schreuders-Koedam, Marijke; Verhoeven, Jeroen; Janssen, Mark; Dekkers, Dick Hw; Demmers, Jeroen Aa; Eijken, Marco; van de Peppel, Jeroen; van Leeuwen, Johannes Ptm; van der Eerden, Bram Cj. Identification of Chloride Intracellular Channel Protein 3 as a Novel Gene Affecting Human Bone Formation. Jbmr Plus. 2017;1(1):16-26. PubMed |