Anti PTBP2 pAb (ATL-HPA047420)

Atlas Antibodies

Catalog No.:
ATL-HPA047420-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: polypyrimidine tract binding protein 2
Gene Name: PTBP2
Alternative Gene Name: brPTB, nPTB, PTB, PTBLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028134: 100%, ENSRNOG00000010827: 100%
Entrez Gene ID: 58155
Uniprot ID: Q9UKA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQPALDPAIAAAFAKETSLLAVPGALSPLAI
Gene Sequence GQPALDPAIAAAFAKETSLLAVPGALSPLAI
Gene ID - Mouse ENSMUSG00000028134
Gene ID - Rat ENSRNOG00000010827
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTBP2 pAb (ATL-HPA047420)
Datasheet Anti PTBP2 pAb (ATL-HPA047420) Datasheet (External Link)
Vendor Page Anti PTBP2 pAb (ATL-HPA047420) at Atlas Antibodies

Documents & Links for Anti PTBP2 pAb (ATL-HPA047420)
Datasheet Anti PTBP2 pAb (ATL-HPA047420) Datasheet (External Link)
Vendor Page Anti PTBP2 pAb (ATL-HPA047420)