Anti PSTK pAb (ATL-HPA037781)

Atlas Antibodies

Catalog No.:
ATL-HPA037781-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphoseryl-tRNA kinase
Gene Name: PSTK
Alternative Gene Name: C10orf89, MGC35392
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063179: 81%, ENSRNOG00000020605: 83%
Entrez Gene ID: 118672
Uniprot ID: Q8IV42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPPETIHLMGRKLEKPNPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAEDNMEQKDTDRIICSTN
Gene Sequence LPPETIHLMGRKLEKPNPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAEDNMEQKDTDRIICSTN
Gene ID - Mouse ENSMUSG00000063179
Gene ID - Rat ENSRNOG00000020605
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSTK pAb (ATL-HPA037781)
Datasheet Anti PSTK pAb (ATL-HPA037781) Datasheet (External Link)
Vendor Page Anti PSTK pAb (ATL-HPA037781) at Atlas Antibodies

Documents & Links for Anti PSTK pAb (ATL-HPA037781)
Datasheet Anti PSTK pAb (ATL-HPA037781) Datasheet (External Link)
Vendor Page Anti PSTK pAb (ATL-HPA037781)