Anti PSRC1 pAb (ATL-HPA056561)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056561-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PSRC1
Alternative Gene Name: DDA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068744: 70%, ENSRNOG00000020013: 67%
Entrez Gene ID: 84722
Uniprot ID: Q6PGN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKR |
| Gene Sequence | NRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKR |
| Gene ID - Mouse | ENSMUSG00000068744 |
| Gene ID - Rat | ENSRNOG00000020013 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSRC1 pAb (ATL-HPA056561) | |
| Datasheet | Anti PSRC1 pAb (ATL-HPA056561) Datasheet (External Link) |
| Vendor Page | Anti PSRC1 pAb (ATL-HPA056561) at Atlas Antibodies |
| Documents & Links for Anti PSRC1 pAb (ATL-HPA056561) | |
| Datasheet | Anti PSRC1 pAb (ATL-HPA056561) Datasheet (External Link) |
| Vendor Page | Anti PSRC1 pAb (ATL-HPA056561) |