Anti PSRC1 pAb (ATL-HPA049315)

Atlas Antibodies

Catalog No.:
ATL-HPA049315-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proline/serine-rich coiled-coil 1
Gene Name: PSRC1
Alternative Gene Name: DDA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068744: 87%, ENSRNOG00000020013: 90%
Entrez Gene ID: 84722
Uniprot ID: Q6PGN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILD
Gene Sequence DLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILD
Gene ID - Mouse ENSMUSG00000068744
Gene ID - Rat ENSRNOG00000020013
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSRC1 pAb (ATL-HPA049315)
Datasheet Anti PSRC1 pAb (ATL-HPA049315) Datasheet (External Link)
Vendor Page Anti PSRC1 pAb (ATL-HPA049315) at Atlas Antibodies

Documents & Links for Anti PSRC1 pAb (ATL-HPA049315)
Datasheet Anti PSRC1 pAb (ATL-HPA049315) Datasheet (External Link)
Vendor Page Anti PSRC1 pAb (ATL-HPA049315)