Anti PSRC1 pAb (ATL-HPA049315)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049315-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PSRC1
Alternative Gene Name: DDA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068744: 87%, ENSRNOG00000020013: 90%
Entrez Gene ID: 84722
Uniprot ID: Q6PGN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILD |
Gene Sequence | DLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILD |
Gene ID - Mouse | ENSMUSG00000068744 |
Gene ID - Rat | ENSRNOG00000020013 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSRC1 pAb (ATL-HPA049315) | |
Datasheet | Anti PSRC1 pAb (ATL-HPA049315) Datasheet (External Link) |
Vendor Page | Anti PSRC1 pAb (ATL-HPA049315) at Atlas Antibodies |
Documents & Links for Anti PSRC1 pAb (ATL-HPA049315) | |
Datasheet | Anti PSRC1 pAb (ATL-HPA049315) Datasheet (External Link) |
Vendor Page | Anti PSRC1 pAb (ATL-HPA049315) |