Anti PSMG2 pAb (ATL-HPA046741)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046741-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PSMG2
Alternative Gene Name: CLAST3, HCCA3, HsT1707, MDS003, MGC15092, PAC2, TNFSF5IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024537: 88%, ENSRNOG00000017729: 85%
Entrez Gene ID: 56984
Uniprot ID: Q969U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLP |
Gene Sequence | IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLP |
Gene ID - Mouse | ENSMUSG00000024537 |
Gene ID - Rat | ENSRNOG00000017729 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSMG2 pAb (ATL-HPA046741) | |
Datasheet | Anti PSMG2 pAb (ATL-HPA046741) Datasheet (External Link) |
Vendor Page | Anti PSMG2 pAb (ATL-HPA046741) at Atlas Antibodies |
Documents & Links for Anti PSMG2 pAb (ATL-HPA046741) | |
Datasheet | Anti PSMG2 pAb (ATL-HPA046741) Datasheet (External Link) |
Vendor Page | Anti PSMG2 pAb (ATL-HPA046741) |