Anti PSMD7 pAb (ATL-HPA049824 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049824-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
Gene Name: PSMD7
Alternative Gene Name: MOV34, P40, Rpn8, S12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039067: 100%, ENSRNOG00000014097: 98%
Entrez Gene ID: 5713
Uniprot ID: P51665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLE
Gene Sequence TFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLE
Gene ID - Mouse ENSMUSG00000039067
Gene ID - Rat ENSRNOG00000014097
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMD7 pAb (ATL-HPA049824 w/enhanced validation)
Datasheet Anti PSMD7 pAb (ATL-HPA049824 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMD7 pAb (ATL-HPA049824 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PSMD7 pAb (ATL-HPA049824 w/enhanced validation)
Datasheet Anti PSMD7 pAb (ATL-HPA049824 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMD7 pAb (ATL-HPA049824 w/enhanced validation)