Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038807-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PSMD4
Alternative Gene Name: AF, AF-1, Rpn10, S5A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005625: 87%, ENSRNOG00000021042: 96%
Entrez Gene ID: 5710
Uniprot ID: P55036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA |
| Gene Sequence | AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA |
| Gene ID - Mouse | ENSMUSG00000005625 |
| Gene ID - Rat | ENSRNOG00000021042 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) | |
| Datasheet | Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) | |
| Datasheet | Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) |
| Citations for Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) – 1 Found |
| Tran, Huy Minh; Wu, Kuo-Sheng; Sung, Shian-Ying; Changou, Chun Austin; Hsieh, Tsung-Han; Liu, Yun-Ru; Liu, Yen-Lin; Tsai, Min-Lan; Lee, Hsin-Lun; Hsieh, Kevin Li-Chun; Huang, Wen-Chang; Liang, Muh-Lii; Chen, Hsin-Hung; Lee, Yi-Yen; Lin, Shih-Chieh; Ho, Donald Ming-Tak; Chang, Feng-Chi; Chao, Meng-En; Chen, Wan; Chu, Shing-Shung; Yu, Alice L; Yen, Yun; Chang, Che-Chang; Wong, Tai-Tong. Upregulation of Protein Synthesis and Proteasome Degradation Confers Sensitivity to Proteasome Inhibitor Bortezomib in Myc-Atypical Teratoid/Rhabdoid Tumors. Cancers. 2020;12(3) PubMed |