Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038807-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Gene Name: PSMD4
Alternative Gene Name: AF, AF-1, Rpn10, S5A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005625: 87%, ENSRNOG00000021042: 96%
Entrez Gene ID: 5710
Uniprot ID: P55036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Gene Sequence AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Gene ID - Mouse ENSMUSG00000005625
Gene ID - Rat ENSRNOG00000021042
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation)
Datasheet Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation)
Datasheet Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation)
Citations for Anti PSMD4 pAb (ATL-HPA038807 w/enhanced validation) – 1 Found
Tran, Huy Minh; Wu, Kuo-Sheng; Sung, Shian-Ying; Changou, Chun Austin; Hsieh, Tsung-Han; Liu, Yun-Ru; Liu, Yen-Lin; Tsai, Min-Lan; Lee, Hsin-Lun; Hsieh, Kevin Li-Chun; Huang, Wen-Chang; Liang, Muh-Lii; Chen, Hsin-Hung; Lee, Yi-Yen; Lin, Shih-Chieh; Ho, Donald Ming-Tak; Chang, Feng-Chi; Chao, Meng-En; Chen, Wan; Chu, Shing-Shung; Yu, Alice L; Yen, Yun; Chang, Che-Chang; Wong, Tai-Tong. Upregulation of Protein Synthesis and Proteasome Degradation Confers Sensitivity to Proteasome Inhibitor Bortezomib in Myc-Atypical Teratoid/Rhabdoid Tumors. Cancers. 2020;12(3)  PubMed