Anti PSMD12 pAb (ATL-HPA023119)

Atlas Antibodies

Catalog No.:
ATL-HPA023119-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
Gene Name: PSMD12
Alternative Gene Name: p55, Rpn5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020720: 94%, ENSRNOG00000003117: 95%
Entrez Gene ID: 5718
Uniprot ID: O00232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEH
Gene Sequence WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEH
Gene ID - Mouse ENSMUSG00000020720
Gene ID - Rat ENSRNOG00000003117
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMD12 pAb (ATL-HPA023119)
Datasheet Anti PSMD12 pAb (ATL-HPA023119) Datasheet (External Link)
Vendor Page Anti PSMD12 pAb (ATL-HPA023119) at Atlas Antibodies

Documents & Links for Anti PSMD12 pAb (ATL-HPA023119)
Datasheet Anti PSMD12 pAb (ATL-HPA023119) Datasheet (External Link)
Vendor Page Anti PSMD12 pAb (ATL-HPA023119)