Anti PSMA7 pAb (ATL-HPA047266)

Atlas Antibodies

Catalog No.: ATL-HPA047266-25

Protein Description: proteasome (prosome, macropain) subunit, alpha type, 7
Gene Name: PSMA7
Alternative Gene Name: C6, HSPC, RC6-1, XAPC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026587: 35%, ENSRNOG00000056853: 33%
Entrez Gene ID: 5688
Uniprot ID: O14818
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSGESE
• Gene Sequence: YITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSGESE
• Gene ID - Mouse: ENSMUSG00000026587
• Gene ID - Rat: ENSRNOG00000056853
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.