Anti PSMA7 pAb (ATL-HPA047266)

Atlas Antibodies

Catalog No.:
ATL-HPA047266-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) subunit, alpha type, 7
Gene Name: PSMA7
Alternative Gene Name: C6, HSPC, RC6-1, XAPC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026587: 35%, ENSRNOG00000056853: 33%
Entrez Gene ID: 5688
Uniprot ID: O14818
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSGESE
Gene Sequence YITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSGESE
Gene ID - Mouse ENSMUSG00000026587
Gene ID - Rat ENSRNOG00000056853
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMA7 pAb (ATL-HPA047266)
Datasheet Anti PSMA7 pAb (ATL-HPA047266) Datasheet (External Link)
Vendor Page Anti PSMA7 pAb (ATL-HPA047266) at Atlas Antibodies

Documents & Links for Anti PSMA7 pAb (ATL-HPA047266)
Datasheet Anti PSMA7 pAb (ATL-HPA047266) Datasheet (External Link)
Vendor Page Anti PSMA7 pAb (ATL-HPA047266)