Anti PSMA4 pAb (ATL-HPA060613)

Atlas Antibodies

Catalog No.:
ATL-HPA060613-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) subunit, alpha type, 4
Gene Name: PSMA4
Alternative Gene Name: HC9, HsT17706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032301: 99%, ENSRNOG00000013493: 99%
Entrez Gene ID: 5685
Uniprot ID: P25789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTR
Gene Sequence YIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTR
Gene ID - Mouse ENSMUSG00000032301
Gene ID - Rat ENSRNOG00000013493
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMA4 pAb (ATL-HPA060613)
Datasheet Anti PSMA4 pAb (ATL-HPA060613) Datasheet (External Link)
Vendor Page Anti PSMA4 pAb (ATL-HPA060613) at Atlas Antibodies

Documents & Links for Anti PSMA4 pAb (ATL-HPA060613)
Datasheet Anti PSMA4 pAb (ATL-HPA060613) Datasheet (External Link)
Vendor Page Anti PSMA4 pAb (ATL-HPA060613)