Anti PSMA3 pAb (ATL-HPA000905)

Atlas Antibodies

Catalog No.:
ATL-HPA000905-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) subunit, alpha type, 3
Gene Name: PSMA3
Alternative Gene Name: HC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060073: 98%, ENSRNOG00000007851: 98%
Entrez Gene ID: 5684
Uniprot ID: P25788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL
Gene Sequence FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL
Gene ID - Mouse ENSMUSG00000060073
Gene ID - Rat ENSRNOG00000007851
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMA3 pAb (ATL-HPA000905)
Datasheet Anti PSMA3 pAb (ATL-HPA000905) Datasheet (External Link)
Vendor Page Anti PSMA3 pAb (ATL-HPA000905) at Atlas Antibodies

Documents & Links for Anti PSMA3 pAb (ATL-HPA000905)
Datasheet Anti PSMA3 pAb (ATL-HPA000905) Datasheet (External Link)
Vendor Page Anti PSMA3 pAb (ATL-HPA000905)
Citations for Anti PSMA3 pAb (ATL-HPA000905) – 1 Found
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed