Anti PSMA3 pAb (ATL-HPA000905)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000905-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PSMA3
Alternative Gene Name: HC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060073: 98%, ENSRNOG00000007851: 98%
Entrez Gene ID: 5684
Uniprot ID: P25788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL |
| Gene Sequence | FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL |
| Gene ID - Mouse | ENSMUSG00000060073 |
| Gene ID - Rat | ENSRNOG00000007851 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSMA3 pAb (ATL-HPA000905) | |
| Datasheet | Anti PSMA3 pAb (ATL-HPA000905) Datasheet (External Link) |
| Vendor Page | Anti PSMA3 pAb (ATL-HPA000905) at Atlas Antibodies |
| Documents & Links for Anti PSMA3 pAb (ATL-HPA000905) | |
| Datasheet | Anti PSMA3 pAb (ATL-HPA000905) Datasheet (External Link) |
| Vendor Page | Anti PSMA3 pAb (ATL-HPA000905) |
| Citations for Anti PSMA3 pAb (ATL-HPA000905) – 1 Found |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |