Anti PSCA pAb (ATL-HPA030783)

Atlas Antibodies

Catalog No.:
ATL-HPA030783-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: prostate stem cell antigen
Gene Name: PSCA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022598: 59%, ENSRNOG00000061376: 60%
Entrez Gene ID: 8000
Uniprot ID: O43653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLW
Gene Sequence LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLW
Gene ID - Mouse ENSMUSG00000022598
Gene ID - Rat ENSRNOG00000061376
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSCA pAb (ATL-HPA030783)
Datasheet Anti PSCA pAb (ATL-HPA030783) Datasheet (External Link)
Vendor Page Anti PSCA pAb (ATL-HPA030783) at Atlas Antibodies

Documents & Links for Anti PSCA pAb (ATL-HPA030783)
Datasheet Anti PSCA pAb (ATL-HPA030783) Datasheet (External Link)
Vendor Page Anti PSCA pAb (ATL-HPA030783)