Anti PRSS45 pAb (ATL-HPA060284)

Atlas Antibodies

Catalog No.:
ATL-HPA060284-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protease, serine, 45
Gene Name: PRSS45
Alternative Gene Name: TESSP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047257: 64%, ENSRNOG00000029649: 64%
Entrez Gene ID: 377047
Uniprot ID: Q7RTY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHCIQGTKEYSVVLGTSKLQPMNFSRALWVPVRDIIMHPKYWGRAFIMGDVALVHLQTP
Gene Sequence AHCIQGTKEYSVVLGTSKLQPMNFSRALWVPVRDIIMHPKYWGRAFIMGDVALVHLQTP
Gene ID - Mouse ENSMUSG00000047257
Gene ID - Rat ENSRNOG00000029649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRSS45 pAb (ATL-HPA060284)
Datasheet Anti PRSS45 pAb (ATL-HPA060284) Datasheet (External Link)
Vendor Page Anti PRSS45 pAb (ATL-HPA060284) at Atlas Antibodies

Documents & Links for Anti PRSS45 pAb (ATL-HPA060284)
Datasheet Anti PRSS45 pAb (ATL-HPA060284) Datasheet (External Link)
Vendor Page Anti PRSS45 pAb (ATL-HPA060284)