Anti PRSS45 pAb (ATL-HPA060284)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060284-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PRSS45
Alternative Gene Name: TESSP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047257: 64%, ENSRNOG00000029649: 64%
Entrez Gene ID: 377047
Uniprot ID: Q7RTY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AHCIQGTKEYSVVLGTSKLQPMNFSRALWVPVRDIIMHPKYWGRAFIMGDVALVHLQTP |
| Gene Sequence | AHCIQGTKEYSVVLGTSKLQPMNFSRALWVPVRDIIMHPKYWGRAFIMGDVALVHLQTP |
| Gene ID - Mouse | ENSMUSG00000047257 |
| Gene ID - Rat | ENSRNOG00000029649 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRSS45 pAb (ATL-HPA060284) | |
| Datasheet | Anti PRSS45 pAb (ATL-HPA060284) Datasheet (External Link) |
| Vendor Page | Anti PRSS45 pAb (ATL-HPA060284) at Atlas Antibodies |
| Documents & Links for Anti PRSS45 pAb (ATL-HPA060284) | |
| Datasheet | Anti PRSS45 pAb (ATL-HPA060284) Datasheet (External Link) |
| Vendor Page | Anti PRSS45 pAb (ATL-HPA060284) |