Anti PRSS23 pAb (ATL-HPA030591)

Atlas Antibodies

Catalog No.:
ATL-HPA030591-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protease, serine, 23
Gene Name: PRSS23
Alternative Gene Name: SIG13, SPUVE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039405: 91%, ENSRNOG00000017307: 91%
Entrez Gene ID: 11098
Uniprot ID: O95084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGA
Gene Sequence PWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGA
Gene ID - Mouse ENSMUSG00000039405
Gene ID - Rat ENSRNOG00000017307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRSS23 pAb (ATL-HPA030591)
Datasheet Anti PRSS23 pAb (ATL-HPA030591) Datasheet (External Link)
Vendor Page Anti PRSS23 pAb (ATL-HPA030591) at Atlas Antibodies

Documents & Links for Anti PRSS23 pAb (ATL-HPA030591)
Datasheet Anti PRSS23 pAb (ATL-HPA030591) Datasheet (External Link)
Vendor Page Anti PRSS23 pAb (ATL-HPA030591)