Anti PRR16 pAb (ATL-HPA049254)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049254-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PRR16
Alternative Gene Name: DSC54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073565: 90%, ENSRNOG00000019744: 85%
Entrez Gene ID: 51334
Uniprot ID: Q569H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCD |
Gene Sequence | KCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCD |
Gene ID - Mouse | ENSMUSG00000073565 |
Gene ID - Rat | ENSRNOG00000019744 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRR16 pAb (ATL-HPA049254) | |
Datasheet | Anti PRR16 pAb (ATL-HPA049254) Datasheet (External Link) |
Vendor Page | Anti PRR16 pAb (ATL-HPA049254) at Atlas Antibodies |
Documents & Links for Anti PRR16 pAb (ATL-HPA049254) | |
Datasheet | Anti PRR16 pAb (ATL-HPA049254) Datasheet (External Link) |
Vendor Page | Anti PRR16 pAb (ATL-HPA049254) |