Anti PRR16 pAb (ATL-HPA049254)

Atlas Antibodies

Catalog No.:
ATL-HPA049254-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: proline rich 16
Gene Name: PRR16
Alternative Gene Name: DSC54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073565: 90%, ENSRNOG00000019744: 85%
Entrez Gene ID: 51334
Uniprot ID: Q569H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCD
Gene Sequence KCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCD
Gene ID - Mouse ENSMUSG00000073565
Gene ID - Rat ENSRNOG00000019744
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR16 pAb (ATL-HPA049254)
Datasheet Anti PRR16 pAb (ATL-HPA049254) Datasheet (External Link)
Vendor Page Anti PRR16 pAb (ATL-HPA049254) at Atlas Antibodies

Documents & Links for Anti PRR16 pAb (ATL-HPA049254)
Datasheet Anti PRR16 pAb (ATL-HPA049254) Datasheet (External Link)
Vendor Page Anti PRR16 pAb (ATL-HPA049254)