Anti PROX2 pAb (ATL-HPA045057)

Atlas Antibodies

Catalog No.:
ATL-HPA045057-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: prospero homeobox 2
Gene Name: PROX2
Alternative Gene Name: FLJ36749
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042320: 60%, ENSRNOG00000005054: 58%
Entrez Gene ID: 283571
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLLDPPGHLTQLGRSFQGQVAEGRSEPSPPVGGACKDPLALAALPRRVQLQAGVPVGNLSLAKRLDSPRYPIPPRMTPKPCQDP
Gene Sequence VLLDPPGHLTQLGRSFQGQVAEGRSEPSPPVGGACKDPLALAALPRRVQLQAGVPVGNLSLAKRLDSPRYPIPPRMTPKPCQDP
Gene ID - Mouse ENSMUSG00000042320
Gene ID - Rat ENSRNOG00000005054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PROX2 pAb (ATL-HPA045057)
Datasheet Anti PROX2 pAb (ATL-HPA045057) Datasheet (External Link)
Vendor Page Anti PROX2 pAb (ATL-HPA045057) at Atlas Antibodies

Documents & Links for Anti PROX2 pAb (ATL-HPA045057)
Datasheet Anti PROX2 pAb (ATL-HPA045057) Datasheet (External Link)
Vendor Page Anti PROX2 pAb (ATL-HPA045057)