Anti PROKR2 pAb (ATL-HPA047281)

Atlas Antibodies

Catalog No.:
ATL-HPA047281-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: prokineticin receptor 2
Gene Name: PROKR2
Alternative Gene Name: dJ680N4.3, GPR73b, GPR73L1, GPRg2, KAL3, PKR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050558: 67%, ENSRNOG00000021266: 69%
Entrez Gene ID: 128674
Uniprot ID: Q8NFJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF
Gene Sequence AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF
Gene ID - Mouse ENSMUSG00000050558
Gene ID - Rat ENSRNOG00000021266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PROKR2 pAb (ATL-HPA047281)
Datasheet Anti PROKR2 pAb (ATL-HPA047281) Datasheet (External Link)
Vendor Page Anti PROKR2 pAb (ATL-HPA047281) at Atlas Antibodies

Documents & Links for Anti PROKR2 pAb (ATL-HPA047281)
Datasheet Anti PROKR2 pAb (ATL-HPA047281) Datasheet (External Link)
Vendor Page Anti PROKR2 pAb (ATL-HPA047281)