Anti PRKAR2A pAb (ATL-HPA038268)

Atlas Antibodies

Catalog No.: ATL-HPA038268-25

Protein Description: protein kinase, cAMP-dependent, regulatory, type II, alpha
Gene Name: PRKAR2A
Alternative Gene Name: PRKAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032601: 94%, ENSRNOG00000020284: 94%
Entrez Gene ID: 5576
Uniprot ID: P13861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCH
• Gene Sequence: ERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCH
• Gene ID - Mouse: ENSMUSG00000032601
• Gene ID - Rat: ENSRNOG00000020284
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.