Anti PRELID3B pAb (ATL-HPA047721)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047721-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PRELID3B
Alternative Gene Name: C20orf45, dJ543J19.5, SLMO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016257: 88%, ENSRNOG00000046644: 86%
Entrez Gene ID: 51012
Uniprot ID: Q9Y3B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK |
Gene Sequence | ASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK |
Gene ID - Mouse | ENSMUSG00000016257 |
Gene ID - Rat | ENSRNOG00000046644 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRELID3B pAb (ATL-HPA047721) | |
Datasheet | Anti PRELID3B pAb (ATL-HPA047721) Datasheet (External Link) |
Vendor Page | Anti PRELID3B pAb (ATL-HPA047721) at Atlas Antibodies |
Documents & Links for Anti PRELID3B pAb (ATL-HPA047721) | |
Datasheet | Anti PRELID3B pAb (ATL-HPA047721) Datasheet (External Link) |
Vendor Page | Anti PRELID3B pAb (ATL-HPA047721) |