Anti PRELID3B pAb (ATL-HPA047721)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047721-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRELID3B
Alternative Gene Name: C20orf45, dJ543J19.5, SLMO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016257: 88%, ENSRNOG00000046644: 86%
Entrez Gene ID: 51012
Uniprot ID: Q9Y3B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK |
| Gene Sequence | ASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK |
| Gene ID - Mouse | ENSMUSG00000016257 |
| Gene ID - Rat | ENSRNOG00000046644 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRELID3B pAb (ATL-HPA047721) | |
| Datasheet | Anti PRELID3B pAb (ATL-HPA047721) Datasheet (External Link) |
| Vendor Page | Anti PRELID3B pAb (ATL-HPA047721) at Atlas Antibodies |
| Documents & Links for Anti PRELID3B pAb (ATL-HPA047721) | |
| Datasheet | Anti PRELID3B pAb (ATL-HPA047721) Datasheet (External Link) |
| Vendor Page | Anti PRELID3B pAb (ATL-HPA047721) |