Anti PRELID3B pAb (ATL-HPA047721)

Atlas Antibodies

Catalog No.: ATL-HPA047721-25

Protein Description: PRELI domain containing 3B
Gene Name: PRELID3B
Alternative Gene Name: C20orf45, dJ543J19.5, SLMO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016257: 88%, ENSRNOG00000046644: 86%
Entrez Gene ID: 51012
Uniprot ID: Q9Y3B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK
• Gene Sequence: ASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK
• Gene ID - Mouse: ENSMUSG00000016257
• Gene ID - Rat: ENSRNOG00000046644
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.