Anti PRDM15 pAb (ATL-HPA029256)

Atlas Antibodies

Catalog No.: ATL-HPA029256-25

Protein Description: PR domain containing 15
Gene Name: PRDM15
Alternative Gene Name: C21orf83, ZNF298
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014039: 76%, ENSRNOG00000001620: 75%
Entrez Gene ID: 63977
Uniprot ID: P57071
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKPMLKQAGSGVHAAGTPENSAPVESEPSQWACKVCSATFLELQLLNEHLLGHLEQAKSLPPGSQSEAAAPEKEQD
• Gene Sequence: DKPMLKQAGSGVHAAGTPENSAPVESEPSQWACKVCSATFLELQLLNEHLLGHLEQAKSLPPGSQSEAAAPEKEQD
• Gene ID - Mouse: ENSMUSG00000014039
• Gene ID - Rat: ENSRNOG00000001620
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.