Anti PRAME pAb (ATL-HPA045153 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045153-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: preferentially expressed antigen in melanoma
Gene Name: PRAME
Alternative Gene Name: CT130, MAPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028591: 55%, ENSRNOG00000037035: 55%
Entrez Gene ID: 23532
Uniprot ID: P78395
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
Gene Sequence LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
Gene ID - Mouse ENSMUSG00000028591
Gene ID - Rat ENSRNOG00000037035
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRAME pAb (ATL-HPA045153 w/enhanced validation)
Datasheet Anti PRAME pAb (ATL-HPA045153 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRAME pAb (ATL-HPA045153 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRAME pAb (ATL-HPA045153 w/enhanced validation)
Datasheet Anti PRAME pAb (ATL-HPA045153 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRAME pAb (ATL-HPA045153 w/enhanced validation)
Citations for Anti PRAME pAb (ATL-HPA045153 w/enhanced validation) – 5 Found
Field, Matthew G; Decatur, Christina L; Kurtenbach, Stefan; Gezgin, Gülçin; van der Velden, Pieter A; Jager, Martine J; Kozak, Kaleigh N; Harbour, J William. PRAME as an Independent Biomarker for Metastasis in Uveal Melanoma. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2016;22(5):1234-42.  PubMed
Zhang, Wa; Barger, Carter J; Eng, Kevin H; Klinkebiel, David; Link, Petra A; Omilian, Angela; Bshara, Wiam; Odunsi, Kunle; Karpf, Adam R. PRAME expression and promoter hypomethylation in epithelial ovarian cancer. Oncotarget. 2016;7(29):45352-45369.  PubMed
Oyama, Kenji; Kanki, Keita; Shimizu, Hiroki; Kono, Yohei; Azumi, Junya; Toriguchi, Kan; Hatano, Etsuro; Shiota, Goshi. Impact of Preferentially Expressed Antigen of Melanoma on the Prognosis of Hepatocellular Carcinoma. Gastrointestinal Tumors. 2017;3(3-4):128-135.  PubMed
Chang, Aaron Y; Dao, Tao; Gejman, Ron S; Jarvis, Casey A; Scott, Andrew; Dubrovsky, Leonid; Mathias, Melissa D; Korontsvit, Tatyana; Zakhaleva, Victoriya; Curcio, Michael; Hendrickson, Ronald C; Liu, Cheng; Scheinberg, David A. A therapeutic T cell receptor mimic antibody targets tumor-associated PRAME peptide/HLA-I antigens. The Journal Of Clinical Investigation. 2017;127(7):2705-2718.  PubMed
Taniguchi, Yohei; Ishida, Mitsuaki; Saito, Tomohito; Ryota, Hironori; Utsumi, Takahiro; Maru, Natsumi; Matsui, Hiroshi; Hino, Haruaki; Tsuta, Koji; Murakawa, Tomohiro. Preferentially expressed antigen in melanoma as a novel diagnostic marker differentiating thymic squamous cell carcinoma from thymoma. Scientific Reports. 2020;10(1):12286.  PubMed