Anti PPT1 pAb (ATL-HPA021546 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021546-25

Protein Description: palmitoyl-protein thioesterase 1
Gene Name: PPT1
Alternative Gene Name: CLN1, INCL, PPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028657: 85%, ENSRNOG00000012616: 87%
Entrez Gene ID: 5538
Uniprot ID: P50897
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY
• Gene Sequence: KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY
• Gene ID - Mouse: ENSMUSG00000028657
• Gene ID - Rat: ENSRNOG00000012616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPT1 pAb (ATL-HPA021546 w/enhanced validation) – 4 Found

Pezzini, Francesco; Bianchi, Marzia; Benfatto, Salvatore; Griggio, Francesca; Doccini, Stefano; Carrozzo, Rosalba; Dapkunas, Arvydas; Delledonne, Massimo; Santorelli, Filippo M; Lalowski, Maciej M; Simonati, Alessandro. The Networks of Genes Encoding Palmitoylated Proteins in Axonal and Synaptic Compartments Are Affected in PPT1 Overexpressing Neuronal-Like Cells. Frontiers In Molecular Neuroscience. 10( 28878621):266. 

Zingler, Philipp; Särchen, Vinzenz; Glatter, Timo; Caning, Lotta; Saggau, Carina; Kathayat, Rahul S; Dickinson, Bryan C; Adam, Dieter; Schneider-Brachert, Wulf; Schütze, Stefan; Fritsch, Jürgen. Palmitoylation is required for TNF-R1 signaling. Cell Communication And Signaling : Ccs. 2019;17(1):90. 

Scifo, Enzo; Szwajda, Agnieszka; Soliymani, Rabah; Pezzini, Francesco; Bianchi, Marzia; Dapkunas, Arvydas; Dębski, Janusz; Uusi-Rauva, Kristiina; Dadlez, Michał; Gingras, Anne-Claude; Tyynelä, Jaana; Simonati, Alessandro; Jalanko, Anu; Baumann, Marc H; Lalowski, Maciej. Quantitative analysis of PPT1 interactome in human neuroblastoma cells. Data In Brief. 2015;4( 26217791):207-16. 

Rebecca, Vito W; Nicastri, Michael C; Fennelly, Colin; Chude, Cynthia I; Barber-Rotenberg, Julie S; Ronghe, Amruta; McAfee, Quentin; McLaughlin, Noel P; Zhang, Gao; Goldman, Aaron R; Ojha, Rani; Piao, Shengfu; Noguera-Ortega, Estela; Martorella, Alessandra; Alicea, Gretchen M; Lee, Jennifer J; Schuchter, Lynn M; Xu, Xiaowei; Herlyn, Meenhard; Marmorstein, Ronen; Gimotty, Phyllis A; Speicher, David W; Winkler, Jeffrey D; Amaravadi, Ravi K. PPT1 Promotes Tumor Growth and Is the Molecular Target of Chloroquine Derivatives in Cancer. Cancer Discovery. 2019;9(2):220-229.