Anti PPP4R4 pAb (ATL-HPA041866)

Atlas Antibodies

Catalog No.:
ATL-HPA041866-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 4, regulatory subunit 4
Gene Name: PPP4R4
Alternative Gene Name: CFAP14, KIAA1622, PP4R4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021209: 98%, ENSRNOG00000054052: 96%
Entrez Gene ID: 57718
Uniprot ID: Q6NUP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR
Gene Sequence SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR
Gene ID - Mouse ENSMUSG00000021209
Gene ID - Rat ENSRNOG00000054052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP4R4 pAb (ATL-HPA041866)
Datasheet Anti PPP4R4 pAb (ATL-HPA041866) Datasheet (External Link)
Vendor Page Anti PPP4R4 pAb (ATL-HPA041866) at Atlas Antibodies

Documents & Links for Anti PPP4R4 pAb (ATL-HPA041866)
Datasheet Anti PPP4R4 pAb (ATL-HPA041866) Datasheet (External Link)
Vendor Page Anti PPP4R4 pAb (ATL-HPA041866)