Anti PPP4R3A pAb (ATL-HPA002568)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002568-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPP4R3A
Alternative Gene Name: FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041846: 98%, ENSRNOG00000027773: 97%
Entrez Gene ID: 55671
Uniprot ID: Q6IN85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDK |
| Gene Sequence | DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDK |
| Gene ID - Mouse | ENSMUSG00000041846 |
| Gene ID - Rat | ENSRNOG00000027773 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP4R3A pAb (ATL-HPA002568) | |
| Datasheet | Anti PPP4R3A pAb (ATL-HPA002568) Datasheet (External Link) |
| Vendor Page | Anti PPP4R3A pAb (ATL-HPA002568) at Atlas Antibodies |
| Documents & Links for Anti PPP4R3A pAb (ATL-HPA002568) | |
| Datasheet | Anti PPP4R3A pAb (ATL-HPA002568) Datasheet (External Link) |
| Vendor Page | Anti PPP4R3A pAb (ATL-HPA002568) |