Anti PPP4R3A pAb (ATL-HPA002568)

Atlas Antibodies

Catalog No.:
ATL-HPA002568-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 4, regulatory subunit 3A
Gene Name: PPP4R3A
Alternative Gene Name: FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041846: 98%, ENSRNOG00000027773: 97%
Entrez Gene ID: 55671
Uniprot ID: Q6IN85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDK
Gene Sequence DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDK
Gene ID - Mouse ENSMUSG00000041846
Gene ID - Rat ENSRNOG00000027773
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP4R3A pAb (ATL-HPA002568)
Datasheet Anti PPP4R3A pAb (ATL-HPA002568) Datasheet (External Link)
Vendor Page Anti PPP4R3A pAb (ATL-HPA002568) at Atlas Antibodies

Documents & Links for Anti PPP4R3A pAb (ATL-HPA002568)
Datasheet Anti PPP4R3A pAb (ATL-HPA002568) Datasheet (External Link)
Vendor Page Anti PPP4R3A pAb (ATL-HPA002568)