Anti PPP2R5E pAb (ATL-HPA006034)

Atlas Antibodies

Catalog No.: ATL-HPA006034-25

Protein Description: protein phosphatase 2, regulatory subunit B', epsilon isoform
Gene Name: PPP2R5E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021051: 99%, ENSRNOG00000005045: 99%
Entrez Gene ID: 5529
Uniprot ID: Q16537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH
• Gene Sequence: MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH
• Gene ID - Mouse: ENSMUSG00000021051
• Gene ID - Rat: ENSRNOG00000005045
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP2R5E pAb (ATL-HPA006034) – 2 Found

Varadkar, Prajakta; Abbasi, Fatima; Takeda, Kazuyo; Dyson, Jade J; McCright, Brent. PP2A-B56γ is required for an efficient spindle assembly checkpoint. Cell Cycle (Georgetown, Tex.). 2017;16(12):1210-1219. 

DeGrande, Sean T; Little, Sean C; Nixon, Derek J; Wright, Patrick; Snyder, Jedidiah; Dun, Wen; Murphy, Nathaniel; Kilic, Ahmet; Higgins, Robert; Binkley, Philip F; Boyden, Penelope A; Carnes, Cynthia A; Anderson, Mark E; Hund, Thomas J; Mohler, Peter J. Molecular mechanisms underlying cardiac protein phosphatase 2A regulation in heart. The Journal Of Biological Chemistry. 2013;288(2):1032-46.