Anti PPP2R3B pAb (ATL-HPA026606)

Atlas Antibodies

Catalog No.:
ATL-HPA026606-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 2 regulatory subunit B''beta
Gene Name: PPP2R3B
Alternative Gene Name: PPP2R3L, PPP2R3LY, PR48, PR70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043154: 60%, ENSRNOG00000022999: 60%
Entrez Gene ID: 28227
Uniprot ID: Q9Y5P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQ
Gene Sequence KTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQ
Gene ID - Mouse ENSMUSG00000043154
Gene ID - Rat ENSRNOG00000022999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP2R3B pAb (ATL-HPA026606)
Datasheet Anti PPP2R3B pAb (ATL-HPA026606) Datasheet (External Link)
Vendor Page Anti PPP2R3B pAb (ATL-HPA026606) at Atlas Antibodies

Documents & Links for Anti PPP2R3B pAb (ATL-HPA026606)
Datasheet Anti PPP2R3B pAb (ATL-HPA026606) Datasheet (External Link)
Vendor Page Anti PPP2R3B pAb (ATL-HPA026606)