Anti PPP2R2D pAb (ATL-HPA042770)

Atlas Antibodies

Catalog No.: ATL-HPA042770-25

Protein Description: protein phosphatase 2, regulatory subunit B, delta
Gene Name: PPP2R2D
Alternative Gene Name: MDS026
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041769: 100%, ENSRNOG00000016940: 100%
Entrez Gene ID: 55844
Uniprot ID: Q66LE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM
• Gene Sequence: FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM
• Gene ID - Mouse: ENSMUSG00000041769
• Gene ID - Rat: ENSRNOG00000016940
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.