Anti PPP2R2D pAb (ATL-HPA042770)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042770-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PPP2R2D
Alternative Gene Name: MDS026
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041769: 100%, ENSRNOG00000016940: 100%
Entrez Gene ID: 55844
Uniprot ID: Q66LE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM |
| Gene Sequence | FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM |
| Gene ID - Mouse | ENSMUSG00000041769 |
| Gene ID - Rat | ENSRNOG00000016940 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP2R2D pAb (ATL-HPA042770) | |
| Datasheet | Anti PPP2R2D pAb (ATL-HPA042770) Datasheet (External Link) |
| Vendor Page | Anti PPP2R2D pAb (ATL-HPA042770) at Atlas Antibodies |
| Documents & Links for Anti PPP2R2D pAb (ATL-HPA042770) | |
| Datasheet | Anti PPP2R2D pAb (ATL-HPA042770) Datasheet (External Link) |
| Vendor Page | Anti PPP2R2D pAb (ATL-HPA042770) |