Anti PPP2R1B pAb (ATL-HPA018908)

Atlas Antibodies

Catalog No.: ATL-HPA018908-25

Protein Description: protein phosphatase 2, regulatory subunit A, beta
Gene Name: PPP2R1B
Alternative Gene Name: PP2A-Abeta, PR65B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032058: 79%, ENSRNOG00000010922: 32%
Entrez Gene ID: 5519
Uniprot ID: P30154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD
• Gene Sequence: NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD
• Gene ID - Mouse: ENSMUSG00000032058
• Gene ID - Rat: ENSRNOG00000010922
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.