Anti PPP2R1B pAb (ATL-HPA018908)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018908-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PPP2R1B
Alternative Gene Name: PP2A-Abeta, PR65B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032058: 79%, ENSRNOG00000010922: 32%
Entrez Gene ID: 5519
Uniprot ID: P30154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD |
| Gene Sequence | NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD |
| Gene ID - Mouse | ENSMUSG00000032058 |
| Gene ID - Rat | ENSRNOG00000010922 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP2R1B pAb (ATL-HPA018908) | |
| Datasheet | Anti PPP2R1B pAb (ATL-HPA018908) Datasheet (External Link) |
| Vendor Page | Anti PPP2R1B pAb (ATL-HPA018908) at Atlas Antibodies |
| Documents & Links for Anti PPP2R1B pAb (ATL-HPA018908) | |
| Datasheet | Anti PPP2R1B pAb (ATL-HPA018908) Datasheet (External Link) |
| Vendor Page | Anti PPP2R1B pAb (ATL-HPA018908) |