Anti PPP1R42 pAb (ATL-HPA028628 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028628-25

Protein Description: protein phosphatase 1, regulatory subunit 42
Gene Name: PPP1R42
Alternative Gene Name: dtr, LRRC67, TLLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025916: 85%, ENSRNOG00000006804: 86%
Entrez Gene ID: 286187
Uniprot ID: Q7Z4L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNYATN
• Gene Sequence: MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNYATN
• Gene ID - Mouse: ENSMUSG00000025916
• Gene ID - Rat: ENSRNOG00000006804
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP1R42 pAb (ATL-HPA028628 w/enhanced validation) – 2 Found

DeVaul, Nicole; Koloustroubis, Katerina; Wang, Rong; Sperry, Ann O. A novel interaction between kinase activities in regulation of cilia formation. Bmc Cell Biology. 2017;18(1):33. 

DeVaul, Nicole; Wang, Rong; Sperry, Ann O. PPP1R42, a PP1 binding protein, regulates centrosome dynamics in ARPE-19 cells. Biology Of The Cell. 2013;105(8):359-71.