Anti PPP1R42 pAb (ATL-HPA024313)

Atlas Antibodies

Catalog No.: ATL-HPA024313-25

Protein Description: protein phosphatase 1, regulatory subunit 42
Gene Name: PPP1R42
Alternative Gene Name: dtr, LRRC67, TLLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025916: 83%, ENSRNOG00000006804: 67%
Entrez Gene ID: 286187
Uniprot ID: Q7Z4L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLGT
• Gene Sequence: HSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLGT
• Gene ID - Mouse: ENSMUSG00000025916
• Gene ID - Rat: ENSRNOG00000006804
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.