Anti PPP1R3D pAb (ATL-HPA041146)

Atlas Antibodies

Catalog No.: ATL-HPA041146-25

Protein Description: protein phosphatase 1, regulatory subunit 3D
Gene Name: PPP1R3D
Alternative Gene Name: PPP1R6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049999: 91%, ENSRNOG00000053869: 89%
Entrez Gene ID: 5509
Uniprot ID: O95685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL
• Gene Sequence: ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL
• Gene ID - Mouse: ENSMUSG00000049999
• Gene ID - Rat: ENSRNOG00000053869
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.