Anti PPP1R3C pAb (ATL-HPA027041)

Atlas Antibodies

Catalog No.:
ATL-HPA027041-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory subunit 3C
Gene Name: PPP1R3C
Alternative Gene Name: PPP1R5, PTG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067279: 86%, ENSRNOG00000018494: 84%
Entrez Gene ID: 5507
Uniprot ID: Q9UQK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDL
Gene Sequence PRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDL
Gene ID - Mouse ENSMUSG00000067279
Gene ID - Rat ENSRNOG00000018494
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R3C pAb (ATL-HPA027041)
Datasheet Anti PPP1R3C pAb (ATL-HPA027041) Datasheet (External Link)
Vendor Page Anti PPP1R3C pAb (ATL-HPA027041) at Atlas Antibodies

Documents & Links for Anti PPP1R3C pAb (ATL-HPA027041)
Datasheet Anti PPP1R3C pAb (ATL-HPA027041) Datasheet (External Link)
Vendor Page Anti PPP1R3C pAb (ATL-HPA027041)