Anti PPP1R35 pAb (ATL-HPA021604)

Atlas Antibodies

Catalog No.:
ATL-HPA021604-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory subunit 35
Gene Name: PPP1R35
Alternative Gene Name: C7orf47, MGC22793
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029725: 81%, ENSRNOG00000050881: 82%
Entrez Gene ID: 221908
Uniprot ID: Q8TAP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA
Gene Sequence NAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA
Gene ID - Mouse ENSMUSG00000029725
Gene ID - Rat ENSRNOG00000050881
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R35 pAb (ATL-HPA021604)
Datasheet Anti PPP1R35 pAb (ATL-HPA021604) Datasheet (External Link)
Vendor Page Anti PPP1R35 pAb (ATL-HPA021604) at Atlas Antibodies

Documents & Links for Anti PPP1R35 pAb (ATL-HPA021604)
Datasheet Anti PPP1R35 pAb (ATL-HPA021604) Datasheet (External Link)
Vendor Page Anti PPP1R35 pAb (ATL-HPA021604)