Anti PPME1 pAb (ATL-HPA043900)

Atlas Antibodies

Catalog No.:
ATL-HPA043900-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein phosphatase methylesterase 1
Gene Name: PPME1
Alternative Gene Name: PME-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030718: 99%, ENSRNOG00000017227: 99%
Entrez Gene ID: 51400
Uniprot ID: Q9Y570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG
Gene Sequence PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG
Gene ID - Mouse ENSMUSG00000030718
Gene ID - Rat ENSRNOG00000017227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPME1 pAb (ATL-HPA043900)
Datasheet Anti PPME1 pAb (ATL-HPA043900) Datasheet (External Link)
Vendor Page Anti PPME1 pAb (ATL-HPA043900) at Atlas Antibodies

Documents & Links for Anti PPME1 pAb (ATL-HPA043900)
Datasheet Anti PPME1 pAb (ATL-HPA043900) Datasheet (External Link)
Vendor Page Anti PPME1 pAb (ATL-HPA043900)