Anti PPME1 pAb (ATL-HPA043900)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043900-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPME1
Alternative Gene Name: PME-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030718: 99%, ENSRNOG00000017227: 99%
Entrez Gene ID: 51400
Uniprot ID: Q9Y570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG |
| Gene Sequence | PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG |
| Gene ID - Mouse | ENSMUSG00000030718 |
| Gene ID - Rat | ENSRNOG00000017227 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPME1 pAb (ATL-HPA043900) | |
| Datasheet | Anti PPME1 pAb (ATL-HPA043900) Datasheet (External Link) |
| Vendor Page | Anti PPME1 pAb (ATL-HPA043900) at Atlas Antibodies |
| Documents & Links for Anti PPME1 pAb (ATL-HPA043900) | |
| Datasheet | Anti PPME1 pAb (ATL-HPA043900) Datasheet (External Link) |
| Vendor Page | Anti PPME1 pAb (ATL-HPA043900) |