Anti PPM1J pAb (ATL-HPA046045)

Atlas Antibodies

Catalog No.:
ATL-HPA046045-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1J
Gene Name: PPM1J
Alternative Gene Name: DKFZp434P1514, FLJ35951, MGC19531, PP2Czeta, PPP2CZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002228: 94%, ENSRNOG00000012481: 94%
Entrez Gene ID: 333926
Uniprot ID: Q5JR12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD
Gene Sequence PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD
Gene ID - Mouse ENSMUSG00000002228
Gene ID - Rat ENSRNOG00000012481
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPM1J pAb (ATL-HPA046045)
Datasheet Anti PPM1J pAb (ATL-HPA046045) Datasheet (External Link)
Vendor Page Anti PPM1J pAb (ATL-HPA046045) at Atlas Antibodies

Documents & Links for Anti PPM1J pAb (ATL-HPA046045)
Datasheet Anti PPM1J pAb (ATL-HPA046045) Datasheet (External Link)
Vendor Page Anti PPM1J pAb (ATL-HPA046045)