Anti PPM1D pAb (ATL-HPA022277)

Atlas Antibodies

Catalog No.: ATL-HPA022277-25

Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1D
Gene Name: PPM1D
Alternative Gene Name: PP2C-DELTA, Wip1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020525: 97%, ENSRNOG00000003329: 97%
Entrez Gene ID: 8493
Uniprot ID: O15297
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT
• Gene Sequence: KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT
• Gene ID - Mouse: ENSMUSG00000020525
• Gene ID - Rat: ENSRNOG00000003329
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPM1D pAb (ATL-HPA022277) – 1 Found

Yin, Hong-Lei; Xu, Hong-Wei; Lin, Qing-Yan. miR129-1 regulates protein phosphatase 1D protein expression under hypoxic conditions in non-small cell lung cancer cells harboring a TP53 mutation. Oncology Letters. 2020;20(3):2239-2247.