Anti PPM1D pAb (ATL-HPA022277)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022277-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PPM1D
Alternative Gene Name: PP2C-DELTA, Wip1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020525: 97%, ENSRNOG00000003329: 97%
Entrez Gene ID: 8493
Uniprot ID: O15297
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT |
| Gene Sequence | KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT |
| Gene ID - Mouse | ENSMUSG00000020525 |
| Gene ID - Rat | ENSRNOG00000003329 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPM1D pAb (ATL-HPA022277) | |
| Datasheet | Anti PPM1D pAb (ATL-HPA022277) Datasheet (External Link) |
| Vendor Page | Anti PPM1D pAb (ATL-HPA022277) at Atlas Antibodies |
| Documents & Links for Anti PPM1D pAb (ATL-HPA022277) | |
| Datasheet | Anti PPM1D pAb (ATL-HPA022277) Datasheet (External Link) |
| Vendor Page | Anti PPM1D pAb (ATL-HPA022277) |
| Citations for Anti PPM1D pAb (ATL-HPA022277) – 1 Found |
| Yin, Hong-Lei; Xu, Hong-Wei; Lin, Qing-Yan. miR129-1 regulates protein phosphatase 1D protein expression under hypoxic conditions in non-small cell lung cancer cells harboring a TP53 mutation. Oncology Letters. 2020;20(3):2239-2247. PubMed |