Anti PPIP5K1 pAb (ATL-HPA039380)

Atlas Antibodies

Catalog No.: ATL-HPA039380-25

Protein Description: diphosphoinositol pentakisphosphate kinase 1
Gene Name: PPIP5K1
Alternative Gene Name: HISPPD2A, IPS1, KIAA0377, VIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033526: 60%, ENSRNOG00000014436: 57%
Entrez Gene ID: 9677
Uniprot ID: Q6PFW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPS
• Gene Sequence: CLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPS
• Gene ID - Mouse: ENSMUSG00000033526
• Gene ID - Rat: ENSRNOG00000014436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPIP5K1 pAb (ATL-HPA039380) – 1 Found

Khaled, Mariam Lofty; Bykhovskaya, Yelena; Gu, Chunfang; Liu, Alice; Drewry, Michelle D; Chen, Zhong; Mysona, Barbara A; Parker, Emily; McNabb, Ryan P; Yu, Hongfang; Lu, Xiaowen; Wang, Jing; Li, Xiaohui; Al-Muammar, Abdulrahman; Rotter, Jerome I; Porter, Louise F; Estes, Amy; Watsky, Mitchell A; Smith, Sylvia B; Xu, Hongyan; Abu-Amero, Khaled K; Kuo, Anthony; Shears, Stephen B; Rabinowitz, Yaron S; Liu, Yutao. PPIP5K2 and PCSK1 are Candidate Genetic Contributors to Familial Keratoconus. Scientific Reports. 2019;9(1):19406.