Anti PPIA pAb (ATL-HPA058345)

Atlas Antibodies

Catalog No.:
ATL-HPA058345-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: peptidylprolyl isomerase A (cyclophilin A)
Gene Name: PPIA
Alternative Gene Name: CYPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071866: 82%, ENSRNOG00000027864: 79%
Entrez Gene ID: 5478
Uniprot ID: P62937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG
Gene Sequence FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG
Gene ID - Mouse ENSMUSG00000071866
Gene ID - Rat ENSRNOG00000027864
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPIA pAb (ATL-HPA058345)
Datasheet Anti PPIA pAb (ATL-HPA058345) Datasheet (External Link)
Vendor Page Anti PPIA pAb (ATL-HPA058345) at Atlas Antibodies

Documents & Links for Anti PPIA pAb (ATL-HPA058345)
Datasheet Anti PPIA pAb (ATL-HPA058345) Datasheet (External Link)
Vendor Page Anti PPIA pAb (ATL-HPA058345)