Anti PPIA pAb (ATL-HPA058345)
Atlas Antibodies
- SKU:
- ATL-HPA058345-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PPIA
Alternative Gene Name: CYPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071866: 82%, ENSRNOG00000027864: 79%
Entrez Gene ID: 5478
Uniprot ID: P62937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG |
Gene Sequence | FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG |
Gene ID - Mouse | ENSMUSG00000071866 |
Gene ID - Rat | ENSRNOG00000027864 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPIA pAb (ATL-HPA058345) | |
Datasheet | Anti PPIA pAb (ATL-HPA058345) Datasheet (External Link) |
Vendor Page | Anti PPIA pAb (ATL-HPA058345) at Atlas Antibodies |
Documents & Links for Anti PPIA pAb (ATL-HPA058345) | |
Datasheet | Anti PPIA pAb (ATL-HPA058345) Datasheet (External Link) |
Vendor Page | Anti PPIA pAb (ATL-HPA058345) |