Anti PPCDC pAb (ATL-HPA045667 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045667-25

• 
• 
• 

Protein Description: phosphopantothenoylcysteine decarboxylase
Gene Name: PPCDC
Alternative Gene Name: FLJ14585, MDS018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063849: 90%, ENSRNOG00000053404: 88%
Entrez Gene ID: 60490
Uniprot ID: Q96CD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIV
• Gene Sequence: LLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIV
• Gene ID - Mouse: ENSMUSG00000063849
• Gene ID - Rat: ENSRNOG00000053404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.