Anti PPBP pAb (ATL-HPA008354)

Atlas Antibodies

Catalog No.:
ATL-HPA008354-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
Gene Name: PPBP
Alternative Gene Name: b-TG1, Beta-TG, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, NAP-2-L1, PBP, SCYB7, TGB, TGB1, THBGB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029380: 47%, ENSRNOG00000002802: 47%
Entrez Gene ID: 5473
Uniprot ID: P02775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Gene Sequence GQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Gene ID - Mouse ENSMUSG00000029380
Gene ID - Rat ENSRNOG00000002802
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPBP pAb (ATL-HPA008354)
Datasheet Anti PPBP pAb (ATL-HPA008354) Datasheet (External Link)
Vendor Page Anti PPBP pAb (ATL-HPA008354) at Atlas Antibodies

Documents & Links for Anti PPBP pAb (ATL-HPA008354)
Datasheet Anti PPBP pAb (ATL-HPA008354) Datasheet (External Link)
Vendor Page Anti PPBP pAb (ATL-HPA008354)
Citations for Anti PPBP pAb (ATL-HPA008354) – 1 Found
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed