Anti PPA1 pAb (ATL-HPA019878)

Atlas Antibodies

Catalog No.: ATL-HPA019878-25

Protein Description: pyrophosphatase (inorganic) 1
Gene Name: PPA1
Alternative Gene Name: IOPPP, PP, PP1, Ppase, SID6-8061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020089: 95%, ENSRNOG00000000557: 91%
Entrez Gene ID: 5464
Uniprot ID: Q15181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK
• Gene Sequence: GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK
• Gene ID - Mouse: ENSMUSG00000020089
• Gene ID - Rat: ENSRNOG00000000557
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPA1 pAb (ATL-HPA019878) – 1 Found

Guo, Chunlei; Li, Shuang; Liang, Ang; Cui, Mengchao; Lou, Yunwei; Wang, Hui. PPA1 Promotes Breast Cancer Proliferation and Metastasis Through PI3K/AKT/GSK3β Signaling Pathway. Frontiers In Cell And Developmental Biology. 9( 34595179):730558.