Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037855-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: POGLUT1
Alternative Gene Name: 9630046K23Rik, C3orf9, hCLP46, KDELCL1, KTELC1, MDS010, MDSRP, MGC32995, Rumi
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034064: 86%, ENSRNOG00000003014: 89%
Entrez Gene ID: 56983
Uniprot ID: Q8NBL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL |
| Gene Sequence | VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL |
| Gene ID - Mouse | ENSMUSG00000034064 |
| Gene ID - Rat | ENSRNOG00000003014 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) | |
| Datasheet | Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) | |
| Datasheet | Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) |