Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037855-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein O-glucosyltransferase 1
Gene Name: POGLUT1
Alternative Gene Name: 9630046K23Rik, C3orf9, hCLP46, KDELCL1, KTELC1, MDS010, MDSRP, MGC32995, Rumi
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034064: 86%, ENSRNOG00000003014: 89%
Entrez Gene ID: 56983
Uniprot ID: Q8NBL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
Gene Sequence VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
Gene ID - Mouse ENSMUSG00000034064
Gene ID - Rat ENSRNOG00000003014
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation)
Datasheet Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation)
Datasheet Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti POGLUT1 pAb (ATL-HPA037855 w/enhanced validation)