Anti POC1A pAb (ATL-HPA040600 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040600-25

Protein Description: POC1 centriolar protein A
Gene Name: POC1A
Alternative Gene Name: DKFZP434C245, WDR51A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023345: 80%, ENSRNOG00000037295: 79%
Entrez Gene ID: 25886
Uniprot ID: Q8NBT0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKSNFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQEPVSVPQTLTSTLEH
• Gene Sequence: RLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKSNFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQEPVSVPQTLTSTLEH
• Gene ID - Mouse: ENSMUSG00000023345
• Gene ID - Rat: ENSRNOG00000037295
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti POC1A pAb (ATL-HPA040600 w/enhanced validation) – 1 Found

Chen, Jian-Hua; Segni, Maria; Payne, Felicity; Huang-Doran, Isabel; Sleigh, Alison; Adams, Claire; Savage, David B; O'Rahilly, Stephen; Semple, Robert K; Barroso, Inês. Truncation of POC1A associated with short stature and extreme insulin resistance. Journal Of Molecular Endocrinology. 2015;55(2):147-58.