Anti PNPLA8 pAb (ATL-HPA020083)

Atlas Antibodies

Catalog No.: ATL-HPA020083-25

Protein Description: patatin-like phospholipase domain containing 8
Gene Name: PNPLA8
Alternative Gene Name: IPLA2-2, IPLA2G, iPLA2gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036257: 68%, ENSRNOG00000039091: 69%
Entrez Gene ID: 50640
Uniprot ID: Q9NP80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
• Gene Sequence: DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
• Gene ID - Mouse: ENSMUSG00000036257
• Gene ID - Rat: ENSRNOG00000039091
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PNPLA8 pAb (ATL-HPA020083) – 2 Found

Pattabiraman, Padmanabhan P; Lih, Fred B; Tomer, Kenneth B; Rao, Ponugoti Vasantha. The role of calcium-independent phospholipase A2γ in modulation of aqueous humor drainage and Ca2+ sensitization of trabecular meshwork contraction. American Journal Of Physiology. Cell Physiology. 2012;302(7):C979-91. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.